SLC14A1 Rabbit Polyclonal Antibody

CAT#: TA346523

Rabbit Polyclonal Anti-SLC14A1 Antibody

Product Images

WB Suggested Anti-SLC14A1 Antibody Titration: 0.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC14A1 antibody: synthetic peptide directed towards the C terminal of human SLC14A1. Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: solute carrier family 14 member 1 (Kidd blood group)
• Database Link:
  NP_056949
  Entrez Gene 6563 Human
  UniProt ID Q13336
• Background: The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system. [provided by RefSeq, Mar 2009]
• Synonyms: HsT1341; HUT11; JK; RACH1; RACH2; UT-B1; UT1; UTE
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Sheep: 93%; Bovine: 86%; Horse: 83%; Mouse: 83%

Reference Data

• Protein Families: Transmembrane