Tekt1 Rabbit Polyclonal Antibody

CAT#: TA346524

Rabbit Polyclonal Anti-Tekt1 Antibody

Product Images

Host: Rabbit; Target Name: Tekt1; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tekt1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tekt1. Synthetic peptide located within the following region: EEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: tektin 1
• Database Link:
  NP_035699
  Entrez Gene 21689 Mouse
  UniProt ID Q9DAJ2
• Background: Structural component of ciliary and flagellar microtubules. Forms filamentous polymers in the walls of ciliary and flagellar microtubules.
• Synonyms: MT14
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 86%; Guinea pig: 86%