ornithine aminotransferase (OAT) Rabbit Polyclonal Antibody

CAT#: TA346529

Rabbit Polyclonal Anti-OAT Antibody

Product Images

Host: Rabbit; Target Name: OAT; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: OAT; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: OAT; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-OAT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: 293T cell lysate.OAT is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OAT antibody: synthetic peptide directed towards the middle region of human OAT. Synthetic peptide located within the following region: RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: ornithine aminotransferase
• Database Link:
  NP_000265
  Entrez Gene 18242 MouseEntrez Gene 4942 Human
  UniProt ID P04181
• Background: This gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Related pseudogenes have been defined on the X chromosome. [provided by RefSeq, Jan 2010]
• Synonyms: GACR; HOGA; OATASE; OKT
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Zebrafish: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways