EIF3E Rabbit Polyclonal Antibody

CAT#: TA346552

Rabbit Polyclonal Anti-EIF3E Antibody

Product Images

EIF3E antibody - N-terminal region validated by WB using B8 mouse cells and HEK293 human cells at 1: 1, 000.

• 

  WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate.EIF3E is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3E antibody: synthetic peptide directed towards the N terminal of human EIF3E. Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit E
• Database Link:
  NP_001559
  Entrez Gene 16341 MouseEntrez Gene 3646 Human
  UniProt ID P60228
• Background: EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
• Synonyms: eIF3-p46; EIF3-P48; EIF3S6; INT6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%