ENO3 Rabbit Polyclonal Antibody

CAT#: TA346568

Rabbit Polyclonal Anti-ENO3 Antibody

Product Images

WB Suggested Anti-ENO3 Antibody Titration: 0.25 ug/ml; Positive Control: Jurkat cell lysate

• 

  ENO3 antibody in Human Heart using Western blot

• 

  ENO3 antibody in Human Liver using Western blot

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: enolase 3
• Database Link:
  NP_001967
  Entrez Gene 2027 Human
  UniProt ID P13929
• Background: This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2010]
• Synonyms: GSD13; MSE
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation