Aspartate Aminotransferase (GOT1) Rabbit Polyclonal Antibody

CAT#: TA346570

Rabbit Polyclonal Anti-GOT1 Antibody

Product Images

Host: Rabbit; Target Name: GOT1; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-GOT1 Antibody Titration: 1.0 ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate.GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226

• 

  Host: Rabbit; Target Name: GOT1; Sample Tissue: NCI-H226; Antibody Dilution: 1.0 ug/ml.GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: glutamic-oxaloacetic transaminase 1
• Database Link:
  NP_002070
  Entrez Gene 2805 Human
  UniProt ID P17174
• Background: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq, Jul 2008]
• Synonyms: ASTQTL1; cAspAT; cCAT; GIG18
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 92%; Zebrafish: 85%

Reference Data

• Protein Pathways: Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylalanine metabolism, Tyrosine metabolism