ACP6 Rabbit Polyclonal Antibody

CAT#: TA346625

Rabbit Polyclonal Anti-ACP6 Antibody

Product Images

WB Suggested Anti-ACP6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysateACP6 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACP6 antibody: synthetic peptide directed towards the N terminal of human ACP6. Synthetic peptide located within the following region: EQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMFA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: acid phosphatase 6, lysophosphatidic
• Database Link:
  NP_057445
  Entrez Gene 51205 Human
  UniProt ID Q9NPH0
• Background: ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Synonyms: ACPL1; LPAP; PACPL1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Bovine: 86%; Dog: 79%; Pig: 77%; Horse: 77%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Riboflavin metabolism