C20orf19 (KIZ) Rabbit Polyclonal Antibody

CAT#: TA346629

Rabbit Polyclonal Anti-C20orf19 Antibody

Product Images

WB Suggested Anti-C20orf19 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C20orf19 antibody: synthetic peptide directed towards the C terminal of human C20orf19. Synthetic peptide located within the following region: SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: kizuna centrosomal protein
• Database Link:
  NP_060944
  Entrez Gene 55857 Human
  UniProt ID Q2M2Z5
• Background: The protein encoded by this gene localizes to centrosomes, strengthening and stabilizing the pericentriolar region prior to spindle formation. The encoded protein usually remains with the mother centrosome after centrosomal duplication. Sevral transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]
• Synonyms: C20orf19; HT013; Kizuna; NCRNA00153; PLK1S1; RP69
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 81%