PPP1R11 Rabbit Polyclonal Antibody

CAT#: TA346638

Rabbit Polyclonal Anti-PPP1R11 Antibody

Product Images

WB Suggested Anti-PPP1R11 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: OVCAR-3 cell lysate.PPP1R11 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP1R11 antibody: synthetic peptide directed towards the N terminal of human PPP1R11. Synthetic peptide located within the following region: MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: protein phosphatase 1 regulatory inhibitor subunit 11
• Database Link:
  NP_068778
  Entrez Gene 6992 Human
  UniProt ID O60927
• Background: This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq, Jul 2008]
• Synonyms: HCG-V; HCGV; IPP3; TCTE5; TCTEX5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome