GPSN2 (TECR) Rabbit Polyclonal Antibody

CAT#: TA346654

Rabbit Polyclonal Anti-GPSN2 Antibody

Product Images

WB Suggested Anti-GPSN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPSN2 antibody: synthetic peptide directed towards the C terminal of human GPSN2. Synthetic peptide located within the following region: LRPAGSKTRKIPYPTKNPFTWLFLLVSCPNYTYEVGSWIGFAIMTQCLPV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: trans-2,3-enoyl-CoA reductase
• Database Link:
  NP_612510
  Entrez Gene 9524 Human
  UniProt ID Q9NZ01
• Background: This gene encodes a multi-pass membrane protein that resides in the endoplasmic reticulum, and belongs to the steroid 5-alpha reductase family. The elongation of microsomal long and very long chain fatty acid consists of 4 sequential reactions. This protein catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2011]
• Synonyms: GPSN2; MRT14; SC2; TER
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Biosynthesis of unsaturated fatty acids