ATPase Inhibitory Factor 1 (ATPIF1) Rabbit Polyclonal Antibody

CAT#: TA346663

Rabbit Polyclonal Anti-ATPIF1 Antibody

Product Images

WB Suggested Anti-ATPIF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate.ATPIF1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATPIF1 antibody: synthetic peptide directed towards the N terminal of human ATPIF1. Synthetic peptide located within the following region: GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: ATPase inhibitory factor 1
• Database Link:
  NP_057395
  Entrez Gene 93974 Human
  UniProt ID Q9UII2
• Background: This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: ATPI; ATPIP; IP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 86%; Zebrafish: 79%