NEK2 Rabbit Polyclonal Antibody

CAT#: TA346711

Rabbit Polyclonal Anti-NEK2 Antibody

Product Images

Host: Rabbit; Target Name: NEK2; Sample Tissue: HT1080 lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NEK2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEK2. Synthetic peptide located within the following region: RCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: NIMA related kinase 2
• Database Link:
  NP_002488
  Entrez Gene 4751 Human
  UniProt ID P51955
• Background: This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene. [provided by RefSeq, Feb 2011]
• Synonyms: HsPK21; NEK2A; NLK1; PPP1R111; RP67
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase