Stk25 Rabbit Polyclonal Antibody

CAT#: TA346752

Rabbit Polyclonal Anti-Stk25 Antibody

Product Images

WB Suggested Anti-Stk25 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Stk25 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: serine/threonine kinase 25
• Database Link:
  NP_908938
  Entrez Gene 373542 Rat
• Background: human homolog is a member of the Ste20-like kinase family which is activated by cellular, particularly oxidant, stress but which does not activate either of the stress-activated MAP kinase cascades (p38 and SAPKs) [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AY346152.1, BC087092.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
• Synonyms: DKFZp686J1430; OTTHUMP00000200205; SOK-1; SOK1; YSK1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Bovine: 86%