QPCT Rabbit Polyclonal Antibody

CAT#: TA346769

Rabbit Polyclonal Anti-QPCT Antibody

Product Images

WB Suggested Anti-QPCT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-QPCT antibody: synthetic peptide directed towards the middle region of human QPCT. Synthetic peptide located within the following region: SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: glutaminyl-peptide cyclotransferase
• Database Link:
  NP_036545
  Entrez Gene 25797 Human
  UniProt ID Q16769
• Background: This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008]
• Synonyms: GCT; QC; sQC
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 86%; Bovine: 86%; Dog: 79%; Horse: 79%; Mouse: 79%

Reference Data

• Protein Families: Protease