UGCGL2 (UGGT2) Rabbit Polyclonal Antibody

CAT#: TA346804

Rabbit Polyclonal Anti-UGCGL2 Antibody

Product Images

WB Suggested Anti-UGCGL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate. UGGT2 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UGCGL2 antibody: synthetic peptide directed towards the N terminal of human UGCGL2. Synthetic peptide located within the following region: KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 172 kDa
• Gene Name: UDP-glucose glycoprotein glucosyltransferase 2
• Database Link:
  NP_064506
  Entrez Gene 55757 Human
  UniProt ID Q9NYU1
• Background: UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER. [supplied by OMIM, Oct 2009]. ##Evidence-Data-START## Transcript exon combination :: AF227906.2, BC125233.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: HUGT2; UGCGL2; UGT2
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 92%; Rat: 86%