MATN1 Rabbit Polyclonal Antibody

CAT#: TA346860

Rabbit Polyclonal Anti-MATN1 Antibody

Product Images

WB Suggested Anti-MATN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: OVCAR-3 cell lysateMATN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MATN1 antibody: synthetic peptide directed towards the middle region of human MATN1. Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: matrilin 1, cartilage matrix protein
• Database Link:
  NP_002370
  Entrez Gene 4146 Human
  UniProt ID P21941
• Background: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha
• Synonyms: CMP; CRTM
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%