GUCY1B1 Rabbit Polyclonal Antibody

CAT#: TA356597

GUCY1B1 Antibody

Product Images

Host: Rabbit Target Name: GUCY1B3 Sample Tissue: Human HepG2 Whole cell Antibody Dilution: 1ug/ml

Specifications

Product Data

• Reactivities: Human
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
• Specificity: Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
  Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 71 kDa
• Gene Name: guanylate cyclase 1, soluble, beta 3
• Database Link:
  NP_000848
  Entrez Gene 2983 Human
  UniProt ID Q02153
• Background: This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants.
• Synonyms: GC-S-beta-1; GC-SB3; GCS-beta-1; GCS-beta-3; GUC1B3; GUCB3; GUCSB3; GUCY1B1

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Long-term depression, Purine metabolism, Vascular smooth muscle contraction