MYO15A Rabbit Polyclonal Antibody

CAT#: TA358765

MYO15A Antibody

Product Images

Rabbit Anti-MYO15A antibody Catalog Number: ARP64703 Formalin Fixed Paraffin Embedded Tissue: Human Pancreas Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SASAFFWGLHTGPQKTKRKRKARTVLKSTSKLMTQMRMGKKKRAMKGKKP
• Specificity: Expected reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat
  Homology: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rat: 93%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 395 kDa
• Gene Name: myosin XVA
• Database Link:
  NP_057323
  Entrez Gene 51168 Human
  UniProt ID Q9UKN7
• Background: This gene encodes an unconventional myosin. This protein differs from other myosins in that it has a long N-terminal extension preceding the conserved motor domain. Studies in mice suggest that this protein is necessary for actin organization in the hair cells of the cochlea. Mutations in this gene have been associated with profound, congenital, neurosensory, nonsyndromal deafness. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Read-through transcripts containing an upstream gene and this gene have been identified, but they are not thought to encode a fusion protein. Several alternatively spliced transcript variants have been described, but their full length sequences have not been determined.
• Synonyms: DFNB3; DKFZp686N18198; FLJ17274; FLJ31311; MYO15