Fabp5 (BC002008) Mouse Tagged ORF Clone

CAT#: MG200811

Fabp5 (GFP-tagged) - Mouse fatty acid binding protein 5, epidermal (cDNA clone MGC:5786 IMAGE:3490535)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Fabp5
• Synonyms: mal1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200811 representing BC002008
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCAGCCTTAAGGATCTCGAAGGGAAGTGGCGCCTGATGGAAAGCCACGGCTTTGAGGAGTACATGA
  AAGAGCTAGGAGTAGGACTGGCTCTTAGGAAGATGGCTGCCATGGCCAAGCCAGACTGTATCATTACGTG
  TGATGGCAACAACATCACGGTCAAAACCGAGAGCACAGTGAAGACGACCGTGTTCTCTTGTAACCTGGGA
  GAGAAGTTTGATGAAACGACAGCTGATGGCAGAAAAACTGAGACGGTCTGCACCTTCCAAGACGGTGCCC
  TGGTCCAGCACCAGCAATGGGACGGGAAGGAGAGCACGATAACAAGAAAACTGAAGGATGGGAAGATGAT
  CGTGGAGTGTGTCATGAACAATGCCACCTGCACTCGGGTCTATGAGAAGGTGCAA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200811 representing BC002008
  Red=Cloning site Green=Tags(s)
  
  MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLG
  EKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ
  
  TRTRRLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC002008
• ORF Size: 405 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: BC002008, AAH02008
• RefSeq Size: 713
• RefSeq ORF: 407
• Locus ID: 16592
• Gene Summary: The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. In humans this gene has been associated with psoriasis and type 2 diabetes. In mouse deficiency of this gene in combination with a deficiency in Fabp4 confers protection against atherosclerosis, diet-induced obesity, insulin resistance and experimental autoimmune encephalomyelitis (the mouse model for multiple sclerosis). Alternative splicing results in multiple transcript variants that encode different protein isoforms. The mouse genome contains many pseudogenes similar to this locus. [provided by RefSeq, Jan 2013]