Sct (BC048484) Mouse Tagged ORF Clone

CAT#: MR200869

  • TrueORF®

Sct (Myc-DDK-tagged) - Mouse secretin (cDNA clone MGC:58269 IMAGE:6707701)


  "BC048484" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

3 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sct
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200869 representing BC048484
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCTCCGCTGCCCACGCCGATGCTACTGCTGTTGCTGCTGCTGCTCTCCAGTTCCGCCGCGCTCC
CTGCACCTCCCAGGACCCCAAGACACTCAGACGGAATGTTCACCAGCGAGCTCAGCCGCTTGCAGGACAG
TGCCAGGCTGCAGCGCCTGCTGCAGGGTCTGGTGGGGAAGCGCAGCGAGCAGGACACAGAAAATATCCCA
GAGAACAGCCTGGCCCGGTCCAAGCCCTTAGAGGACCAGCTCTGCTTGCTGTGGTCGAACACTCAGACCC
TACAGGACTGTCCCCTCTCCTTCCACAGGCTTCTGCCCAGGCTGTCCCTGGATGGGTCCCTGTCTCTCTG
GCTGCCTCCTGGACCAAGGTCTGCTGTTGATCGTTCAGAGTGGACTGAAACAACCAGGCCACCCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200869 representing BC048484
Red=Cloning site Green=Tags(s)

MEPPLPTPMLLLLLLLLSSSAALPAPPRTPRHSDGMFTSELSRLQDSARLQRLLQGLVGKRSEQDTENIP
ENSLARSKPLEDQLCLLWSNTQTLQDCPLSFHRLLPRLSLDGSLSLWLPPGPRSAVDRSEWTETTRPPR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC048484
ORF Size 417 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC048484.1
RefSeq Size 564
RefSeq ORF 419
Locus ID 20287
MW 20.7 kDa
Gene Summary This gene encodes the precursor of a gastrointestinal peptide hormone of the secretin-glucagon family. The encoded protein is secreted as a prohormone that undergoes proteolytic processing to generate a mature peptide hormone. The mature peptide regulates secretion of gastric acid, biocarbonate ions from pancreatic and biliary duct epithelia and water homeostasis in the gastrointestinal system. Mice lacking the encoded protein display decreased survival of neuroprogenitor cells during early postnatal period and impaired long-term potentiation and spatial learning in adulthood. Alternative splicing results in multiple transcript variants encoding different isoforms. All of these isoforms may be processed in a similar manner to generate the mature peptide hormone. [provided by RefSeq, Jul 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.