Spry1 (BC039139) Mouse Tagged ORF Clone

CAT#: MR202508

  • TrueORF®

Spry1 (Myc-DDK-tagged) - Mouse sprouty homolog 1 (Drosophila) (cDNA clone MGC:18307 IMAGE:3672353)


  "BC039139" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 420.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Spry1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Spry1
Synonyms sprouty1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202508 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTCCCCAAGTCAGCATGGCAGCCACACTTCGCTAGTGGTGATTCAGCCACCGGCTGTGGAAGGCC
GGCAGAGGTTAGACTATGACAGGGACACTCAGCCTGCTACGATTCTGTCCCTAGACCAGATCAAAGCCAT
CAGAGGCAGCAATGAATACACAGAGGGACCTTCGGTAGCGAGAAGACCTGCTCCTCGCACTGCACCAAGA
CCCGAAAAGCAGGAAAGGACTCATGAAATCATACCAGCCAATGTGAATAGCAGCTACGAGCACCGACCTG
CCAGCCACCCGGGCAACGCCAGGGGCTCGGTGCTGAGCAGGTCCACCAGCACCGGAAGCGCGGCCAGCTC
AGGGAGCAGCAGCAGTGTGTCTTCTGAGCAGGGCCTATTAGGACGGTCTCCGCCCACCAGGCCCTGCCCT
CCTGTCTGGCCTGTGATCGGCAGTGCCTCTGCTCCGCGGAGAGCATGGTGGAATACGGGACCTGCATGTG
CCTGGTCAAGGGCATTTTCTACCACTGCTCCAATGATGATGATGGAGGTTCTTACTCGGATAACCCATGC
TCCTGTTCACAGTCCCACTGCTGCTCCAGATACCTGTGCATGGGAGCCCTGTCTTTGTGCCTACCCTGCT
TGCTCTGCTACCCTCCCGCCAAGGGCTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202508 protein sequence
Red=Cloning site Green=Tags(s)

MDSPSQHGSHTSLVVIQPPAVEGRQRLDYDRDTQPATILSLDQIKAIRGSNEYTEGPSVARRPAPRTAPR
PEKQERTHEIIPANVNSSYEHRPASHPGNARGSVLSRSTSTGSAASSGSSSSVSSEQGLLGRSPPTRPCP
PVWPVIGSASAPRRAWWNTGPACAWSRAFSTTAPMMMMEVLTRITHAPVHSPTAAPDTCAWEPCLCAYPA
CSATLPPRAA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC039139
ORF Size 660 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC039139, AAH39139
RefSeq Size 2357 bp
RefSeq ORF 662 bp
Locus ID 24063
MW 23.4 kDa
Gene Summary May function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.