Cldn15 (NM_021719) Mouse Tagged ORF Clone

CAT#: MR202708

Cldn15 (Myc-DDK-tagged) - Mouse claudin 15 (Cldn15)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cldn15
• Synonyms: 2210009B08Rik; BB107105
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202708 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGGTAGCTGTGGAGACCTTCGGCTTCTTCATGTCAGCCCTGGGACTGCTGATGCTGGGGTTGACCC
  TTTCAAACAGCTACTGGAGAGTGTCTACGGTCCATGGCAACGTCATCACCACCAACACCATCTTTGAGAA
  CCTGTGGTACAGCTGTGCCACCGACTCCCTGGGAGTCTCCAACTGCTGGGACTTTCCGTCCATGCTGGCC
  CTCTCTGGGTATGTCCAGGGCTGCCGGGCTCTCATGATCACCGCCATCCTCCTGGGCTTCCTGGGCCTCT
  TTCTAGGCATGGTGGGACTCCGCTGCACCAACGTGGGCAACATGGATCTCTCCAAGAAGGCCAAGCTGCT
  GGCCATTGCAGGGACCCTCCACATACTTGCTGGAGCCTGTGGGATGGTGGCTATCTCGTGGTACGCCGTC
  AACATCACTACTGACTTCTTCAACCCACTGTATGCTGGAACCAAGTATGAACTGGGCCCCGCCCTCTACT
  TGGGCTGGAGTGCCTCCCTGCTCTCCATCCTGGGCGGCATCTGTGTCTTCTCCACCTGCTGCTGTTCCTC
  CAAGGAGGAACCAGCCACCAGGGCTGGGCTTCCCTACAAGCCTTCTACGGTTGTGATACCCCGTGCCACC
  TCGGATGAGAGTGACATCAGCTTCGGTAAATATGGCAAAAACGCATACGTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202708 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVSNCWDFPSMLA
  LSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNMDLSKKAKLLAIAGTLHILAGACGMVAISWYAV
  NITTDFFNPLYAGTKYELGPALYLGWSASLLSILGGICVFSTCCCSSKEEPATRAGLPYKPSTVVIPRAT
  SDESDISFGKYGKNAYV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021719
• ORF Size: 684 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021719.1, NM_021719.2, NM_021719.3, NM_021719.4, NP_068365.1
• RefSeq Size: 1878 bp
• RefSeq ORF: 684 bp
• Locus ID: 60363
• MW: 24.3 kDa
• Gene Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein increases permeability for sodium ions in anion-selective epithelial cell sheets. The gene deficiency leads to megaintestine and decreases in intestinal epithelial paracellular ion permeability. This gene is a direct target for hepatocyte-nuclear-factor-4alpha, a mediator of ion epithelial transport, and is down-modulated in inflammatory bowel disease. [provided by RefSeq, Aug 2010]