Uts2 (NM_011910) Mouse Tagged ORF Clone

CAT#: MR218932

  • TrueORF®

Uts2 (Myc-DDK-tagged) - Mouse urotensin 2 (Uts2)


  "NM_011910" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Uts2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Uts2
Synonyms prepro-UII; Ucn2; UII
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR218932 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGGGTGCCCTTCTGCTGCCTGCTCTTCATAGGACTTCTGAATCCACTGCTGTCCCTTCCCGTCA
CGGACACTGGTGAGAGGACTCTTCAGCTTCCAGTGCTTGAGGAAGACGCTCTTCGGGCTCTGGAGGAGCT
GGAGAGGATGGCCCTCCTGCAGACCCTGCGTCAGACCATGGGCACGGAAGCAGGGGAGAGCCCTGGAGAA
GCAGGTCCCAGCACTGAGACTCCCACTCCACGGGGAAGCATGAGGAAGGCTTTCGCTGGGCAAAATTCTA
ACACTGTACTGAGTCGTCTCTTGGCAAGAACCAGGAAACAACATAAGCAACACGGGGCTGCCCCAGAGTG
CTTCTGGAAATACTGCATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR218932 protein sequence
Red=Cloning site Green=Tags(s)

MDRVPFCCLLFIGLLNPLLSLPVTDTGERTLQLPVLEEDALRALEELERMALLQTLRQTMGTEAGESPGE
AGPSTETPTPRGSMRKAFAGQNSNTVLSRLLARTRKQHKQHGAAPECFWKYCI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011910
ORF Size 372 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_011910.1, NM_011910.2, NP_036040.1
RefSeq Size 538
RefSeq ORF 372
Locus ID 24111
MW 13.6 kDa
Gene Summary This gene encodes a member of the urotensin family of peptide hormones. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional hormone before secretion into the plasma. Mice lacking the encoded protein have a significantly decreased low density lipoprotein cholesterol profile and hepatic steatosis that is consistent with decreased hepatocyte de novo cholesterol synthesis and apolipoprotein B secretion. [provided by RefSeq, Sep 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.