Hcrt (NM_010410) Mouse Tagged ORF Clone

CAT#: MR222595

  • TrueORF®

Hcrt (Myc-DDK-tagged) - Mouse hypocretin (Hcrt)


  "NM_010410" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Hcrt"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Hcrt
Synonyms PPOX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR222595 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTTTCCTTCTACAAAGGTTCCCTGGGCCGCCGTGACGCTGCTGCTGCTGCTACTGCTGCCGCCGG
CGCTGCTGTCGCTTGGGGTGGACGCACAGCCTCTGCCCGACTGCTGTCGCCAGAAGACGTGTTCCTGCCG
TCTCTACGAACTGTTGCACGGAGCTGGCAACCACGCTGCGGGTATCCTGACTCTGGGAAAGCGGCGGCCT
GGACCTCCAGGCCTCCAGGGACGGCTGCAGCGCCTCCTTCAGGCCAACGGTAACCACGCAGCTGGCATCC
TGACCATGGGCCGCCGCGCAGGCGCAGAGCTAGAGCCACATCCCTGCTCTGGTCGCGGCTGTCCGACCGT
AACTACCACCGCTTTAGCACCCCGGGGAGGGTCCGGAGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR222595 protein sequence
Red=Cloning site Green=Tags(s)

MNFPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRP
GPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPHPCSGRGCPTVTTTALAPRGGSGV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010410
ORF Size 393 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_010410.1, NM_010410.2, NP_034540.1
RefSeq Size 584
RefSeq ORF 393
Locus ID 15171
MW 13.5 kDa
Gene Summary This gene encodes a hypothalamic neuropeptide precursor protein that gives rise to two mature neuropeptides, orexin A and orexin B, by proteolytic processing. Orexin A and orexin B, which bind to orphan G-protein coupled receptors Hcrtr1 and Hcrtr2, function in the regulation of sleep and arousal. This neuropeptide arrangement may also play a role in feeding behavior, metabolism, and homeostasis. [provided by RefSeq, Sep 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.