Ghrh (NM_010285) Mouse Tagged ORF Clone

CAT#: MR223015

  • TrueORF®

Ghrh (Myc-DDK-tagged) - Mouse growth hormone releasing hormone (Ghrh)


  "NM_010285" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Ghrh"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ghrh
Synonyms Ghrf; GRF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR223015 representing NM_010285
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTCTGGGTGCTCTTTGTGATCCTCATCCTCACCAGTGGCTCCCACTGCTCACTGCCCCCCTCAC
CTCCCTTCAGGATGCAGCGACACGTAGATGCCATCTTCACCACCAACTACAGGAAACTCCTGAGCCAGCT
GTATGCCCGGAAAGTGATCCAGGACATCATGAACAAGCAAGGGGAGAGGATCCAGGAACAAAGGGCCAGG
CTCAGCCGCCAGGAAGACAGCATGTGGACAGAGGACAAGCAGATGACCCTGGAGAGCATCTTGCAGGGAT
TCCCAAGGATGAAGCCTTCAGCGGACGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223015 representing NM_010285
Red=Cloning site Green=Tags(s)

MLLWVLFVILILTSGSHCSLPPSPPFRMQRHVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRAR
LSRQEDSMWTEDKQMTLESILQGFPRMKPSADA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010285
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_010285.1, NM_010285.2, NM_010285.3, NP_034415.1
RefSeq Size 534
RefSeq ORF 312
Locus ID 14601
MW 12.5 kDa
Gene Summary This gene encodes a hormone that has stimulatory effects on pituitary growth hormone synthesis and release, and somatotrope expansion. The encoded preproprotein undergoes proteolytic processing to generate the mature peptide that is secreted by hypothalamus. Mice lacking the encoded protein are deficient in the growth hormone, live longer and exhibit growth retardation, enhanced insulin sensitivity and increased xenobiotic metabolism. [provided by RefSeq, Jul 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.