Gnrh1 (NM_008145) Mouse Tagged ORF Clone
CAT#: MR226103
- TrueORF®
Gnrh1 (Myc-DDK-tagged) - Mouse gonadotropin releasing hormone 1 (Gnrh1)
"NM_008145" in other vectors (4)
Interest in protein/lysate? Submit request here!
Product Images
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Gnrh1 |
Synonyms | Gnrh; Gnrh2; hpg; LHRH; Lhrh1; Lnrh |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR226103 representing NM_008145
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCCTCAAACTGATGGCCGGCATTCTACTGCTGACTGTGTGTTTGGAAGGCTGCTCCAGCCAGCACT GGTCCTATGGGTTGCGCCCTGGGGGAAAGAGAAACACTGAACACTTGGTTGAGTCTTTCCAAGAGATGGG CAAGGAGGTGGATCAAATGGCAGAACCCCAGCACTTCGAATGTACTGTCCACTGGCCCCGTTCACCCCTC AGGGATCTGCGAGGAGCTCTGGAAAGTCTGATTGAAGAGGAAGCCAGGCAGAAGAAGATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR226103 representing NM_008145
Red=Cloning site Green=Tags(s) MILKLMAGILLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVESFQEMGKEVDQMAEPQHFECTVHWPRSPL RDLRGALESLIEEEARQKKM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_008145 |
ORF Size | 270 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_008145.1, NM_008145.2, NM_008145.3, NP_032171.1 |
RefSeq Size | 532 bp |
RefSeq ORF | 273 bp |
Locus ID | 14714 |
Cytogenetics | 14 D1 |
MW | 10.8 kDa |
Gene Summary | This gene encodes hypophysiotropic peptides belonging to the family of gonadotropin-releasing hormones that stimulate the release of gonadotropins and suppress secretion of prolactin from the pituitary gland. The encoded protein is proteolytically processed to generate two biologically active mature peptides. A deletional mutation encompassing the distal half of this gene in mice resulting in the loss of the encoded protein leads to hypogonadism and infertility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208575 | Gnrh1 (untagged) - Mouse gonadotropin releasing hormone 1 (Gnrh1), (10ug) |
USD 420.00 |
|
MG226103 | Gnrh1 (GFP-tagged) - Mouse gonadotropin releasing hormone 1 (Gnrh1), (10ug) |
USD 460.00 |
|
MR226103L3 | Lenti ORF clone of Gnrh1 (Myc-DDK-tagged) - Mouse gonadotropin releasing hormone 1 (Gnrh1) |
USD 620.00 |
|
MR226103L4 | Lenti ORF clone of Gnrh1 (mGFP-tagged) - Mouse gonadotropin releasing hormone 1 (Gnrh1) |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review