Antibodies

View as table Download

Rabbit Polyclonal Anti-GNRH1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNRH1

GnRH (GNRH1) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Mammalian
Conjugation Unconjugated

Rabbit anti-GNRH1 Polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti GnRH-Associated Peptide-1 (hu); purified rabbit IgG

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti GnRH-Associated Peptide-1 (hu); neat antiserum

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti LHRH; purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 coupled to carrier protein.

Rabbit polyclonal anti LHRH; neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 coupled to carrier protein.

Rabbit polyclonal anti LHRH; diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 coupled to carrier protein.

Rabbit polyclonal anti Prolactin Release-Inhibiting Factor (rt); neat antiserum

Applications ELISA
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asn-Thr-Glu-His-Leu-Val-Asp-Ser-Phe-Gln-Glu-Met- Gly-Lys-Glu-Glu-Asp-Gln-Met-Ala-Glu-Pro-Gln-Asn-Phe-Glu-Cys-Thr- Val-His-Trp-Pro-Arg-Ser-Pro-Leu-Arg-Asp-Leu-Arg-Gly-Ala-Leu-Glu-Arg- Leu-Ile-Glu-Glu-Glu-Ala-Gly-Gln-Lys-Lys-Met-OH coupled to a carrier protein.

GNRH1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS

GNRH1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNRH1