Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GnRH (GNRH1) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
Rabbit anti-GNRH1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti GnRH-Associated Peptide-1 (hu); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti GnRH-Associated Peptide-1 (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti LHRH; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 coupled to carrier protein. |
Rabbit polyclonal anti LHRH; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 coupled to carrier protein. |
Rabbit polyclonal anti LHRH; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Prolactin Release-Inhibiting Factor (rt); neat antiserum
| Applications | ELISA |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asn-Thr-Glu-His-Leu-Val-Asp-Ser-Phe-Gln-Glu-Met- Gly-Lys-Glu-Glu-Asp-Gln-Met-Ala-Glu-Pro-Gln-Asn-Phe-Glu-Cys-Thr- Val-His-Trp-Pro-Arg-Ser-Pro-Leu-Arg-Asp-Leu-Arg-Gly-Ala-Leu-Glu-Arg- Leu-Ile-Glu-Glu-Glu-Ala-Gly-Gln-Lys-Lys-Met-OH coupled to a carrier protein. |
GNRH1 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
GNRH1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GNRH1 |
Active filters
Target Symbol
- GNRH1