Twist1 (NM_011658) Mouse Tagged ORF Clone

CAT#: MR227370

  • TrueORF®

Twist1 (Myc-DDK-tagged) - Mouse twist homolog 1 (Drosophila) (Twist1)


  "NM_011658" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 420.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Twist1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Twist1
Synonyms bHLHa38; M-Twist; Pde; pdt; Ska10; Ska; Twist
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227370 representing NM_011658
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCAGGACGTGTCCAGCTCGCCAGTCTCTCCGGCCGACGACAGCCTGAGCAACAGCGAGGAGGAGC
CGGACCGGCAGCAGCCGGCGAGCGGCAAGCGCGGGGCTCGCAAGAGACGCAGCAGTCGGCGCAGCGCGGG
CGGCAGCGCGGGGCCCGGCGGGGCCACGGGCGGGGGCATCGGAGGCGGCGACGAGCCAGGCAGCCCGGCC
CAGGGCAAGCGCGGCAAGAAATCTGCGGGCGGAGGCGGCGGCGGCGGCGCGGGCGGAGGTGGTGGCGGCG
GCGGCGGCAGCAGCAGCGGGGGCGGGAGCCCGCAGTCGTACGAGGAGCTGCAGACCCAGCGGGTCATGGC
TAACGTGCGGGAGCGCCAGCGCACGCAGTCGCTGAACGAGGCGTTCGCCGCCCTGCGCAAGATCATCCCC
ACGCTGCCCTCGGACAAGCTGAGCAAGATTCAGACCCTCAAACTGGCGGCCAGGTACATCGACTTCCTGT
ACCAGGTCCTGCAGAGCGACGAGCTGGACTCCAAGATGGCAAGCTGCAGCTATGTGGCCCACGAGCGGCT
CAGCTACGCCTTCTCCGTCTGGAGGATGGAGGGGGCCTGGTCCATGTCCGCGTCCCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227370 representing NM_011658
Red=Cloning site Green=Tags(s)

MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPA
QGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIP
TLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011658
ORF Size 618 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_011658.1, NM_011658.2, NP_035788.1
RefSeq Size 1665
RefSeq ORF 621
Locus ID 22160
MW 21.6 kDa
Gene Summary Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. This gene encodes a bHLH transcription factor that is evolutionarily conserved from invertebrates to humans, and was originally identified in Drosophila as an essential gene involved in early mesoderm development and dorsal-ventral patterning in the embryo. This protein plays a role in cancer by regulating the epithelial-mesenchymal transition (EMT), a process that is critical for metastasis initiation, and promoting tumor progression. Mutations in the human gene are associated with Saethre-Chotzen syndrome (SCS). Mice with heterozygous mutations in this gene exhibit cranofacial and structural defects similar to those seen in human SCS patients. [provided by RefSeq, Sep 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.