IMP3 (NM_018285) Human Tagged ORF Clone

CAT#: RC200112

IMP3 (Myc-DDK-tagged)-Human IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP3)

Product Images

Western blot validation of overexpression lysate (Cat# LY413095) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200112 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: IMP3
• Synonyms: BRMS2; C15orf12; MRPS4
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200112 representing NM_018285.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGTGCGGAAGCTTAAGTTCCACGAGCAGAAGCTGCTGAAGCAGGTGGACTTCCTGAACTGGGAGGTC
  ACCGACCACAACCTGCACGAGCTGCGCGTGCTGCGGCGTTACCGGCTGCAGCGGCGGGAGGACTACACG
  CGCTACAACCAGCTGAGCCGTGCCGTGCGTGAGCTGGCGCGGCGCCTGCGCGACCTGCCCGAACGCGAC
  CAGTTCCGCGTGCGCGCTTCGGCCGCGCTGCTGGACAAGCTGTATGCTCTCGGCTTGGTGCCCACGCGC
  GGTTCGCTGGAGCTCTGCGACTTCGTCACGGCCTCGTCCTTCTGCCGCCGCCGCCTCCCCACCGTGCTC
  CTCAAGCTGCGCATGGCGCAGCACCTTCAGGCTGCAGTGGCCTTTGTGGAGCAAGGGCACGTACGCGTG
  GGCCCTGACGTGGTTACCGACCCCGCCTTCCTTGTCACGCGCAGCATGGAGGACTTTGTCACTTGGGTG
  GACTCGTCCAAGATCAAGCGGCACGTGCTAGAGTACAATGAGGAGCGCGATGACTTCGATCTGGAAGCC
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
  ATCCTGGATTACAAGGATGACGACGATAAGGTTTAA
  
  Protein Sequence

  >Peptide sequence encoded by RC200112
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERD
  QFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRV
  GPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_018285
• ORF Size: 552 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_018285.1
• RefSeq Size: 1255 bp
• RefSeq ORF: 555 bp
• Locus ID: 55272
• UniProt ID: Q9NV31
• Cytogenetics: 15q24.2
• Domains: S4
• MW: 21.9 kDa
• Gene Summary: This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain. [provided by RefSeq, Jul 2008]