HSPC142 (BABAM1) (NM_014173) Human Tagged ORF Clone

CAT#: RC202644

BABAM1 (Myc-DDK-tagged)-Human BRISC and BRCA1 A complex member 1 (BABAM1), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY415463) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202644 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified BABAM1 protein (Cat# TP302644). The protein was produced from HEK293T cells transfected with BABAM1 cDNA clone (Cat# RC202644) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BABAM1
• Synonyms: C19orf62; HSPC142; MERIT40; NBA1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202644 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAAGTGGCAGAGCCCAGCAGCCCCACTGAAGAGGAGGAGGAGGAAGAGGAGCACTCGGCAGAGCCTC
  GGCCCCGCACTCGCTCCAATCCTGAAGGGGCTGAGGACCGGGCAGTAGGGGCACAGGCCAGCGTGGGCAG
  CCGCAGCGAGGGTGAGGGTGAGGCCGCCAGTGCTGATGATGGGAGCCTCAACACTTCAGGAGCCGGCCCT
  AAGTCCTGGCAGGTGCCCCCGCCAGCCCCTGAGGTCCAAATTCGGACACCAAGGGTCAACTGTCCAGAGA
  AAGTGATTATCTGCCTGGACCTGTCAGAGGAAATGTCACTGCCAAAGCTGGAGTCGTTCAACGGCTCCAA
  AACCAACGCCCTCAATGTCTCCCAGAAGATGATTGAGATGTTCGTGCGGACAAAACACAAGATCGACAAA
  AGCCACGAGTTTGCACTGGTGGTGGTGAACGATGACACGGCCTGGCTGTCTGGCCTGACCTCCGACCCCC
  GCGAGCTCTGTAGCTGCCTCTATGATCTGGAGACGGCCTCCTGTTCCACCTTCAATCTGGAAGGACTTTT
  CAGCCTCATCCAGCAGAAAACTGAGCTTCCGGTCACAGAGAACGTGCAGACGATTCCCCCGCCATATGTG
  GTCCGCACCATCCTTGTCTACAGCCGTCCACCTTGCCAGCCCCAGTTCTCCTTGACGGAGCCCATGAAGA
  AAATGTTCCAGTGCCCATATTTCTTCTTTGACGTTGTTTACATCCACAATGGCACTGAGGAGAAGGAGGA
  GGAGATGAGTTGGAAGGATATGTTTGCCTTCATGGGCAGCCTGGATACCAAGGGTACCAGCTACAAGTAT
  GAGGTGGCACTGGCTGGGCCAGCCCTGGAGTTGCACAACTGCATGGCGAAACTGTTGGCCCACCCCCTGC
  AGCGGCCTTGCCAGAGCCATGCTTCCTACAGCCTGCTGGAGGAGGAGGATGAAGCCATTGAGGTTGAGGC
  CACTGTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202644 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP
  KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK
  SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV
  VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY
  EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014173
• ORF Size: 987 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014173.2, NM_014173.3, NP_054892.2
• RefSeq Size: 1467 bp
• RefSeq ORF: 990 bp
• Locus ID: 29086
• MW: 36.6 kDa
• Gene Summary: Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates (PubMed:24075985, PubMed:26195665). In these 2 complexes, it is probably required to maintain the stability of BABAM2 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression (PubMed:24075985). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985). [UniProtKB/Swiss-Prot Function]