PERP (NM_022121) Human Tagged ORF Clone

CAT#: RC204012

PERP (Myc-DDK-tagged)-Human PERP, TP53 apoptosis effector (PERP)


  "NM_022121" in other vectors (6)

Reconstitution Protocol

USD 118.00

USD 429.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal PERP Antibody
    • 100 ug

USD 430.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Other products for "PERP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PERP
Synonyms dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204012 representing NM_022121.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGATCCGCTGCGGCCTGGCCTGCGAGCGCTGCCGCTGGATCCTGCCCCTGCTCCTACTCAGCGCCATC
GCCTTCGACATCATCGCGCTGGCCGGCCGCGGCTGGTTGCAGTCTAGCGACCACGGCCAGACGTCCTCG
CTGTGGTGGAAATGCTCCCAAGAGGGCGGCGGCAGCGGGTCCTACGAGGAGGGCTGTCAGAGCCTCATG
GAGTACGCGTGGGGTAGAGCAGCGGCTGCCATGCTCTTCTGTGGCTTCATCATCCTGGTGATCTGTTTC
ATCCTCTCCTTCTTCGCCCTCTGTGGACCCCAGATGCTTGTCTTCCTGAGAGTGATTGGAGGTCTCCTT
GCCTTGGCTGCTGTGTTCCAGATCATCTCCCTGGTAATTTACCCCGTGAAGTACACCCAGACCTTCACC
CTTCATGCCAACCCTGCTGTCACTTACATCTATAACTGGGCCTACGGCTTTGGGTGGGCAGCCACGATT
ATCCTGATTGGCTGTGCCTTCTTCTTCTGCTGCCTCCCCAACTACGAAGATGACCTTCTGGGCAATGCC
AAGCCCAGGTACTTCTACACATCTGCC

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
>Peptide sequence encoded by RC204012
Blue=ORF Red=Cloning site Green=Tag(s)

MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLM
EYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFT
LHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC204012 also available, TP304012M
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022121
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022121.5
RefSeq Size 4319 bp
RefSeq ORF 582 bp
Locus ID 64065
UniProt ID Q96FX8
Cytogenetics 6q23.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways p53 signaling pathway
MW 21.4 kDa
Gene Summary Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.