TIGAR (NM_020375) Human Tagged ORF Clone

CAT#: RC204087

C12orf5 (Myc-DDK-tagged)-Human chromosome 12 open reading frame 5 (C12orf5)

Product Images

Western blot validation of overexpression lysate (Cat# LY412517) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC204087 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified TIGAR protein (Cat# TP304087). The protein was produced from HEK293T cells transfected with TIGAR cDNA clone (Cat# RC204087) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: TIGAR
• Synonyms: C12orf5; FR2BP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC204087 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTCGCTTCGCTCTGACTGTTGTCCGGCATGGAGAAACAAGATTTAACAAGGAGAAAATAATCCAAG
  GACAAGGAGTAGATGAACCTCTTTCAGAAACTGGATTTAAACAAGCAGCAGCTGCTGGTATATTTCTGAA
  TAATGTGAAGTTTACTCATGCTTTCTCCAGTGATCTCATGAGGACAAAGCAGACCATGCATGGAATTTTG
  GAGAGAAGCAAATTTTGCAAAGATATGACGGTAAAGTATGACTCAAGACTTCGGGAAAGGAAATACGGGG
  TTGTAGAAGGCAAAGCGCTAAGTGAGCTGAGGGCCATGGCCAAAGCAGCCAGGGAAGAGTGCCCTGTGTT
  TACACCGCCCGGAGGAGAGACGCTGGACCAGGTGAAAATGCGTGGAATAGACTTTTTTGAATTTCTTTGT
  CAACTAATCCTGAAAGAAGCGGATCAAAAAGAACAGTTTTCCCAAGGATCTCCAAGCAACTGTCTGGAAA
  CTTCTTTGGCAGAGATATTTCCTTTAGGAAAAAATCACAGCTCTAAAGTTAATTCAGACAGCGGTATTCC
  AGGATTAGCAGCCAGTGTCTTAGTTGTGAGTCACGGTGCTTACATGAGAAGTCTGTTTGATTATTTTCTG
  ACTGACCTTAAGTGTTCCTTACCAGCCACTCTGAGCAGATCTGAACTTATGTCAGTCACTCCCAATACAG
  GGATGAGTCTCTTTATCATAAACTTTGAGGAAGGAAGAGAAGTTAAACCAACGGTTCAGTGTATTTGTAT
  GAACCTACAGGATCATCTAAATGGACTGACTGAAACTCGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC204087 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL
  ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC
  QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL
  TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_020375
• ORF Size: 810 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_020375.1, NM_020375.2, NP_065108.1
• RefSeq Size: 8237 bp
• RefSeq ORF: 813 bp
• Locus ID: 57103
• Domains: PGAM
• MW: 30.1 kDa
• Gene Summary: This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region. [provided by RefSeq, Jul 2008]