RRAS2 (NM_012250) Human Tagged ORF Clone

CAT#: RC204591

RRAS2 (Myc-DDK-tagged)-Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1


  "NM_012250" in other vectors (5)

Reconstitution Protocol

USD 118.00

USD 429.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)
    • 100 ul

USD 415.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Other products for "RRAS2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RRAS2
Synonyms NS12; TC21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204591 representing NM_012250.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGC
GGCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGTCCTATTTTGTAACGGATTATGATCCAACC
ATTGAAGATTCTTACACAAAGCAGTGTGTGATAGATGACAGAGCAGCCCGGCTAGATATTTTGGATACA
GCAGGACAAGAAGAGTTTGGAGCCATGAGAGAACAGTATATGAGGACTGGCGAAGGCTTCCTGTTGGTC
TTTTCAGTCACAGATAGAGGCAGTTTTGAAGAAATCTATAAGTTTCAAAGACAGATTCTCAGAGTAAAG
GATCGTGATGAGTTCCCAATGATTTTAATTGGTAATAAAGCAGATCTGGATCATCAAAGACAGGTAACA
CAGGAAGAAGGACAACAGTTAGCACGGCAGCTTAAGGTAACATACATGGAGGCATCAGCAAAGATTAGG
ATGAATGTAGATCAAGCTTTCCATGAACTTGTCCGGGTTATCAGGAAATTTCAAGAGCAGGAATGTCCT
CCTTCACCAGAACCAACACGGAAAGAAAAAGACAAGAAAGGCTGCCATTGTGTCATTTTC

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
>Peptide sequence encoded by RC204591
Blue=ORF Red=Cloning site Green=Tag(s)

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDT
AGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVT
QEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC204591 also available, TP304591M
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012250
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012250.6
RefSeq Size 2360 bp
RefSeq ORF 615 bp
Locus ID 22800
UniProt ID P62070
Cytogenetics 11p15.2
Domains ras, RAN, RAS, RHO, RAB
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
MW 23.4 kDa
Gene Summary This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.