CHMP5 (NM_016410) Human Tagged ORF Clone

CAT#: RC204779

CHMP5 (Myc-DDK-tagged)-Human chromatin modifying protein 5 (CHMP5), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY414005) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC204779 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CHMP5
• Synonyms: C9orf83; CGI-34; HSPC177; PNAS-2; SNF7DC2; Vps60
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC204779 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAACCGACTCTTCGGGAAAGCGAAACCCAAGGCTCCGCCGCCCAGCCTGACTGGCTGCATTGGCACGG
  TGGACAGTAGAGCAGAATCCATTGACAAGAAGATTTCTCGATTGGATGCTGAGCTAGTGAAGTATAAGGA
  TCAGATCAAGAAGATGAGAGAGGGTCCTGCAAAGAATATGGTCAAGCAGAAAGCCTTGCGAGTTTTAAAG
  CAAAAGAGGATGTATGAGCAGCAGCGGGACAATCTTGCCCAACAGTCATTCAACATGGAACAAGCCAATT
  ATACCATCCAGTCTTTGAAGGACACCAAGACCACGGTTGATGCTATGAAACTGGGAGTAAAGGAAATGAA
  GAAGGCATACAAGCAAGTGAAGATCGACCAGATTGAGGATTTACAAGACCAGCTAGAGGATATGATGGAA
  GATGCAAATGAAATCCAAGAAGCACTGAGTCGCAGTTATGGCACCCCAGAACTGGATGAAGATGATTTAG
  AAGCAGAGTTGGATGCACTAGGTGATGAGCTTCTGGCTGATGAAGACAGTTCTTATTTGGATGAGGCAGC
  ATCTGCACCTGCAATTCCAGAAGGTGTTCCCACTGATACAAAAAACAAGGATGGAGTTCTGGTGGATGAA
  TTTGGATTGCCACAGATCCCTGCTTCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC204779 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNRLFGKAKPKAPPPSLTGCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLK
  QKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMME
  DANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDE
  FGLPQIPAS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016410
• ORF Size: 657 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016410.1, NM_016410.2, NM_016410.3, NM_016410.4, NM_016410.5, NP_057494.2
• RefSeq Size: 2070 bp
• RefSeq ORF: 660 bp
• Locus ID: 51510
• Domains: DUF279
• Protein Pathways: Endocytosis
• MW: 24.5 kDa
• Gene Summary: CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]). [supplied by OMIM, Mar 2008]