MLLT11 (NM_006818) Human Tagged ORF Clone

CAT#: RC205165

  • TrueORF®

MLLT11 (Myc-DDK-tagged)-Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 11 (MLLT11)


  "NM_006818" in other vectors (6)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "MLLT11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MLLT11
Synonyms AF1Q
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205165 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGACCCTGTGAGTAGCCAGTACAGTTCCTTTCTTTTCTGGAGGATGCCCATCCCAGAACTGGATC
TGTCGGAGCTGGAAGGCCTGGGTCTGTCAGATACAGCCACCTACAAGGTCAAAGACAGCAGCGTTGGCAA
AATGATCGGGCAAGCAACTGCAGCAGACCAGGAGAAAAACCCTGAAGGTGATGGCCTCCTTGAGTACAGC
ACCTTCAACTTCTGGAGAGCTCCCATTGCCAGCATCCACTCCTTCGAACTGGACTTGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205165 protein sequence
Red=Cloning site Green=Tags(s)

MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYS
TFNFWRAPIASIHSFELDLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006818
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006818.1, NM_006818.2, NM_006818.3, NP_006809.1
RefSeq Size 2180 bp
RefSeq ORF 273 bp
Locus ID 10962
MW 10.1 kDa
Gene Summary The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.