MLLT11 (NM_006818) Human Tagged ORF Clone

CAT#: RG205165

  • TrueORF®

MLLT11 (GFP-tagged) - Human myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 (MLLT11)


  "NM_006818" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "MLLT11"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MLLT11
Synonyms AF1Q
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG205165 representing NM_006818
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGACCCTGTGAGTAGCCAGTACAGTTCCTTTCTTTTCTGGAGGATGCCCATCCCAGAACTGGATC
TGTCGGAGCTGGAAGGCCTGGGTCTGTCAGATACAGCCACCTACAAGGTCAAAGACAGCAGCGTTGGCAA
AATGATCGGGCAAGCAACTGCAGCAGACCAGGAGAAAAACCCTGAAGGTGATGGCCTCCTTGAGTACAGC
ACCTTCAACTTCTGGAGAGCTCCCATTGCCAGCATCCACTCCTTCGAACTGGACTTGCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205165 representing NM_006818
Red=Cloning site Green=Tags(s)

MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYS
TFNFWRAPIASIHSFELDLL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006818
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_006818.3, NP_006809.1
RefSeq Size 2180
RefSeq ORF 273
Locus ID 10962
Gene Summary The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.