PEA15 (NM_003768) Human Tagged ORF Clone

CAT#: RC205507

PEA15 (Myc-DDK-tagged)-Human phosphoprotein enriched in astrocytes 15 (PEA15)

Product Images

Western blot validation of overexpression lysate (Cat# LY401240) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205507 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PEA15 protein (Cat# TP305507). The protein was produced from HEK293T cells transfected with PEA15 cDNA clone (Cat# RC205507) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PEA15
• Synonyms: HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED; PED-PEA15; PED/PEA15
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205507 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGAGTACGGGACCCTCCTGCAAGACCTGACCAACAACATCACCCTTGAAGATCTAGAACAGCTCA
  AGTCGGCCTGCAAGGAAGACATCCCCAGCGAAAAGAGTGAGGAGATCACTACTGGCAGTGCCTGGTTTAG
  CTTCCTGGAGAGCCACAACAAGCTGGACAAAGACAACCTCTCCTACATTGAGCACATCTTTGAGATCTCC
  CGCCGTCCTGACCTACTCACTATGGTGGTTGACTACAGAACCCGTGTGCTGAAAATCTCTGAGGAGGATG
  AGCTGGACACCAAGCTAACCCGTATCCCCAGTGCCAAGAAGTACAAAGACATTATCCGGCAGCCCTCTGA
  GGAAGAGATCATCAAATTGGCTCCCCCACCGAAGAAGGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205507 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS
  RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003768
• ORF Size: 390 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003768.1, NM_003768.2, NM_003768.3, NM_003768.4, NP_003759.1
• RefSeq Size: 2509 bp
• RefSeq ORF: 393 bp
• Locus ID: 8682
• Cytogenetics: 1q23.2
• Domains: DED
• Protein Families: Druggable Genome
• MW: 15 kDa
• Gene Summary: This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]