RFXAP (NM_000538) Human Tagged ORF Clone

CAT#: RC205569

RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP)

Product Images

Western blot validation of overexpression lysate (Cat# LY424661) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205569 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RFXAP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205569 representing NM_000538
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGGCGCAGGGTGTAGCGGAGGGCGCGGGGCCGGGCGCCGCCAGCGGCGTGCCCCACCCCGCGGCCC
  TAGCCCCGGCTGCGGCTCCCACCTTGGCGCCAGCCTCGGTGGCGGCCGCGGCCTCTCAATTCACCCTGCT
  AGTGATGCAACCCTGTGCTGGGCAGGACGAGGCTGCGGCCCCCGGGGGCAGCGTTGGGGCGGGCAAGCCC
  GTTAGGTACCTGTGCGAAGGGGCCGGGGATGGCGAAGAGGAGGCTGGGGAGGACGAGGCGGACCTGTTAG
  ACACTTCGGACCCTCCGGGGGGAGGCGAGAGCGCGGCTAGTTTGGAGGATCTAGAGGACGAGGAGACTCA
  CTCGGGGGGCGAGGGCAGCAGCGGGGGCGCCCGGAGGCGGGGCAGCGGTGGGGGCAGCATGAGCAAGACC
  TGCACCTACGAAGGCTGCAGCGAGACCACGAGCCAGGTGGCCAAGCAGCGCAAACCGTGGATGTGCAAGA
  AACACCGCAACAAGATGTACAAGGACAAGTATAAAAAGAAGAAGAGCGACCAGGCCCTGAACTGCGGTGG
  GACTGCCTCGACTGGCAGCGCGGGAAACGTCAAACTCGAGGAAAGTGCAGATAACATACTCTCCATTGTT
  AAACAAAGAACAGGATCTTTTGGGGATCGTCCTGCAAGACCTACTCTTTTAGAACAAGTGTTAAATCAAA
  AAAGACTGTCGTTACTAAGAAGTCCAGAAGTAGTGCAATTTTTACAGAAACAGCAACAGCTATTAAATCA
  GCAAGTTTTGGAGCAAAGACAACAGCAGTTTCCAGGAACATCAATG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205569 representing NM_000538
  Red=Cloning site Green=Tags(s)
  
  MEAQGVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAAPGGSVGAGKP
  VRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKT
  CTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIV
  KQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000538
• ORF Size: 816 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000538.1, NM_000538.2, NM_000538.3, NP_000529.1
• RefSeq Size: 2825 bp
• RefSeq ORF: 819 bp
• Locus ID: 5994
• Cytogenetics: 13q13.3
• Protein Families: Transcription Factors
• Protein Pathways: Antigen processing and presentation, Primary immunodeficiency
• MW: 28.1 kDa
• Gene Summary: 'Major histocompatibility (MHC) class II molecules are transmembrane proteins that have a central role in development and control of the immune system. The protein encoded by this gene, along with regulatory factor X-associated ankyrin-containing protein and regulatory factor-5, forms a complex that binds to the X box motif of certain MHC class II gene promoters and activates their transcription. Once bound to the promoter, this complex associates with the non-DNA-binding factor MHC class II transactivator, which controls the cell type specificity and inducibility of MHC class II gene expression. Mutations in this gene have been linked to bare lymphocyte syndrome type II, complementation group D. Transcript variants utilizing different polyA signals have been found for this gene. [provided by RefSeq, Jul 2008]'