CISH (NM_145071) Human Tagged ORF Clone

CAT#: RC206496

CISH (Myc-DDK-tagged)-Human cytokine inducible SH2-containing protein (CISH), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY403423) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC206496 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CISH
• Synonyms: BACTS2; CIS; CIS-1; G18; SOCS
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC206496 representing NM_145071
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTCCTCTGCGTTCAGGGACCTCGTCCTTTGCTGGCTGTGGAGCGGACTGGGCAGCGGCCCCTGTGGG
  CCCCGTCCCTGGAACTGCCCAAGCCAGTCATGCAGCCCTTGCCTGCTGGGGCCTTCCTCGAGGAGGTGGC
  AGAGGGTACCCCAGCCCAGACAGAGAGTGAGCCAAAGGTGCTGGACCCAGAGGAGGATCTGCTGTGCATA
  GCCAAGACCTTCTCCTACCTTCGGGAATCTGGCTGGTATTGGGGTTCCATTACGGCCAGCGAGGCCCGAC
  AACACCTGCAGAAGATGCCAGAAGGCACGTTCTTAGTACGTGACAGCACGCACCCCAGCTACCTGTTCAC
  GCTGTCAGTGAAAACCACTCGTGGCCCCACCAATGTACGCATTGAGTATGCTGACTCCAGCTTCCGTCTG
  GACTCCAACTGCTTGTCCAGGCCACGCATCCTGGCCTTTCCGGATGTGGTCAGCCTTGTGCAGCACTATG
  TGGCCTCCTGCACTGCTGATACCCGAAGCGACAGCCCCGATCCTGCTCCCACCCCGGCCCTGCCTATGCC
  TAAGGAGGATGCGCCTAGTGACCCAGCACTGCCTGCTCCTCCACCAGCCACTGCTGTACACCTAAAACTG
  GTGCAGCCCTTTGTACGCAGAAGCAGCGCCCGCAGCCTGCAACACCTGTGCCGCCTTGTCATCAACCGTC
  TGGTGGCCGACGTGGACTGCCTGCCACTGCCCCGGCGCATGGCCGACTACCTCCGACAGTACCCCTTCCA
  GCTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC206496 representing NM_145071
  Red=Cloning site Green=Tags(s)
  
  MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCI
  AKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRL
  DSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKL
  VQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_145071
• ORF Size: 774 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_145071.1, NM_145071.2, NP_659508.1
• RefSeq Size: 2035 bp
• RefSeq ORF: 777 bp
• Locus ID: 1154
• Cytogenetics: 3p21.2
• Domains: SH2, SOCS
• Protein Families: Druggable Genome
• Protein Pathways: Jak-STAT signaling pathway
• MW: 28.5 kDa
• Gene Summary: 'The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]'