KIR2DL4 (NM_001080772) Human Tagged ORF Clone

CAT#: RC208307

  • TrueORF®

KIR2DL4 (Myc-DDK-tagged)-Human killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (KIR2DL4), transcript variant 2


  "NM_001080772" in other vectors (4)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "KIR2DL4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KIR2DL4
Synonyms CD158D; G9P; KIR-2DL4; KIR-103AS; KIR103; KIR103AS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208307 representing NM_001080772
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCATGTCACCCACGGTCATCATCCTGGCATGTCTTGGGTTCTTCTTGGACCAGAGTGTGTGGGCAC
ACGTGGGTGGTCAGGACAAGCCCTTCTGCTCTGCCTGGCCCAGCGCTGTGGTGCCTCAAGGAGGACACGT
GACTCTTCGGTGTCACTATCGTCGTGGGTTTAACATCTTCACGCTGTACAAGAAAGATGGGGTCCCTGTC
CCTGAGCTCTACAACAGAATATTCTGGAACAGTTTCCTCATTAGCCCTGTGACCCCAGCACACGCAGGGA
CCTACAGATGTCGAGGTTTTCACCCGCACTCCCCCACTGAGTGGTCGGCACCCAGCAACCCCCTGGTGAT
CATGGTCACAGGTCTATATGAGAAACCTTCGCTTACAGCCCGGCCGGGCCCCACGGTTCGCGCAGGAGAG
AACGTGACCTTGTCCTGCAGCTCCCAGAGCTCCTTTGACATCTACCATCTATCCAGGGAGGGGGAAGCCC
ATGAACTTAGGCTCCCTGCAGTGCCCAGCATCAATGGAACATTCCAGGCCGACTTCCCTCTGGGTCCTGC
CACCCACGGAGAGACCTACAGATGCTTCGGCTCTTTCCATGGATCTCCCTACGAGTGGTCAGACCCGAGT
GACCCACTGCCTGTTTCTGTCACAGGAAACCCTTCTAGTAGTTGGCCTTCACCCACTGAACCAAGCTTCA
AAACTGGTATCGCCAGACACCTGCATGCTGTGATTAGGTACTCAGTGGCCATCATCCTCTTTACCATCCT
TCCCTTCTTTCTCCTTCATCGCTGGTGCTCCAAAAAAAAAATGCTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208307 representing NM_001080772
Red=Cloning site Green=Tags(s)

MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPV
PELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGE
NVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPS
DPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKMLL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001080772
ORF Size 819 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001080772.1, NP_001074241.1
RefSeq Size 1609 bp
RefSeq ORF 822 bp
Locus ID 3805
Cytogenetics 19q13.42
Protein Families Transmembrane
Protein Pathways Antigen processing and presentation, Natural killer cell mediated cytotoxicity
MW 30.3 kDa
Gene Summary 'Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternate alleles of this gene are represented on multiple alternate reference loci (ALT_REF_LOCs). Alternative splicing results in multiple transcript variants, some of which may not be annotated on the primary reference assembly. [provided by RefSeq, Jul 2016]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.