NOLA1 (GAR1) (NM_032993) Human Tagged ORF Clone

CAT#: RC212074

GAR1 (Myc-DDK-tagged)-Human GAR1 ribonucleoprotein homolog (yeast) (GAR1), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY409794) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC212074 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified GAR1 protein (Cat# TP312074). The protein was produced from HEK293T cells transfected with GAR1 cDNA clone (Cat# RC212074) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: GAR1
• Synonyms: NOLA1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212074 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCTTTTCGAGGCGGAGGTCGTGGAGGCTTTAATCGAGGTGGTGGAGGTGGCGGCTTCAACCGAGGCG
  GCAGCAGCAACCACTTCCGAGGTGGAGGCGGCGGTGGAGGCGGCGGCAATTTCAGAGGCGGCGGCAGGGG
  AGGATTTGGACGAGGGGGTGGCCGCGGAGGCTTTAACAAAGGCCAAGACCAAGGACCTCCAGAACGTGTA
  GTCTTATTAGGAGAGTTCCTGCATCCCTGTGAAGATGACATAGTTTGTAAATGTACCACAGATGAAAATA
  AGGTGCCTTATTTCAATGCTCCTGTTTACTTAGAAAACAAAGAACAAATTGGAAAAGTGGATGAAATATT
  TGGACAACTCAGAGATTTTTATTTTTCAGTTAAGTTGTCAGAAAACATGAAGGCTTCATCCTTTAAAAAA
  CTACAGAAGTTTTATATAGACCCATATAAGCTGCTGCCACTGCAGAGGTTTTTACCTCGACCTCCAGGTG
  AGAAAGGACCTCCAAGAGGTGGTGGCAGGGGAGGCCGAGGAGGAGGAAGAGGAGGAGGTGGCAGAGGTGG
  TGGCAGAGGTGGTGGTTTTAGAGGTGGAAGAGGAGGTGGAGGTGGGGGCTTCAGAGGAGGAAGAGGTGGT
  GGTTTCAGAGGGAGAGGACAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212074 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERV
  VLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKK
  LQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGG
  GFRGRGH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_032993
• ORF Size: 651 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_032993.1, NM_032993.2, NP_127460.1
• RefSeq Size: 1021 bp
• RefSeq ORF: 654 bp
• Locus ID: 54433
• Protein Families: Stem cell - Pluripotency
• MW: 22.3 kDa
• Gene Summary: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq, Jul 2008]