KRTAP19-3 (NM_181609) Human Tagged ORF Clone

CAT#: RC214529

KRTAP19 (Myc-DDK-tagged)-Human keratin associated protein 19-3 (KRTAP19-3)

Product Images

Western blot validation of overexpression lysate (Cat# LY405719) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC214529 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: KRTAP19-3
• Synonyms: GTRHP; KAP19.3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC214529 representing NM_181609
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCTACTACGGCAGCTACTATGGAGGCCTGGGCTATGGCTGTGGAGGCTTTGGTGGCCTGGGCTATG
  GCTATGGCTGTGGATGTGGCAGCTTCCGCAGACTGGGTTCTGGCTGTGGCTATGGAGGCTACGGATATGG
  CTCTGGCTTTGGAGGCTATGGATATGGCTCTGGCTTCGGAGGCTACGGATATGGCTGCTACCGCCCATCA
  TACTATGGAGGATATGGATTCTCTGGATTCTAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC214529 representing NM_181609
  Red=Cloning site Green=Tags(s)
  
  MSYYGSYYGGLGYGCGGFGGLGYGYGCGCGSFRRLGSGCGYGGYGYGSGFGGYGYGSGFGGYGYGCYRPS
  YYGGYGFSGFY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_181609
• ORF Size: 243 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_181609.1, NM_181609.2, NM_181609.3, NP_853640.1
• RefSeq Size: 494 bp
• RefSeq ORF: 246 bp
• Locus ID: 337970
• Protein Families: Transmembrane
• MW: 8.1 kDa
• Gene Summary: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins. [UniProtKB/Swiss-Prot Function]