ATF3 (NM_001040619) Human Tagged ORF Clone
CAT#: RC215620
ATF3 (Myc-DDK-tagged)-Human activating transcription factor 3 (ATF3), transcript variant 4
"NM_001040619" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ATF3 |
Synonyms | FLJ41705 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC215620 representing NM_001040619
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGCTTCAACACCCAGGCCAGGTCTCTGCCTCGGAAGTGAGTGCTTCTGCCATCGTCCCCTGCCTGT CCCCTCCTGGGTCACTGGTGTTTGAGGATTTTGCTAACCTGACGCCCTTTGTCAAGGAAGAGCTGAGGTT TGCCATCCAGAACAAGCACCTCTGCCACCGGATGTCCTCTGCGCTGGAATCAGTCACTGTCAGCGACAGA CCCCTCGGGGTGTCCATCACAAAAGCCGAGGTAGCCCCTGAAGAAGATGAAAGGAAAAAGAGGCGACGAG AAAGAAATAAGATTGCAGCTGCAAAGTGCCGAAACAAGAAGAAGGAGAAGACGGAGTGCCTGCAGAAACT CCCAAGGCCCTTTTGGGTCCAGAAGACCTGCATATGGGCTGTTGACTCATGCAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC215620 representing NM_001040619
Red=Cloning site Green=Tags(s) MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDR PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKLPRPFWVQKTCIWAVDSCK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001040619 |
ORF Size | 405 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001040619.1, NM_001040619.2, NP_001035709.1 |
RefSeq Size | 2361 bp |
RefSeq ORF | 408 bp |
Locus ID | 467 |
Cytogenetics | 1q32.3 |
Protein Families | Transcription Factors |
MW | 15.1 kDa |
Gene Summary | 'This gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells, and is involved in the complex process of cellular stress response. Multiple transcript variants encoding different isoforms have been found for this gene. It is possible that alternative splicing of this gene may be physiologically important in the regulation of target genes. [provided by RefSeq, Apr 2011]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC311198 | ATF3 (untagged)-Human activating transcription factor 3 (ATF3), transcript variant 4 |
USD 540.00 |
|
RG215620 | ATF3 (GFP-tagged) - Human activating transcription factor 3 (ATF3), transcript variant 4 |
USD 460.00 |
|
RC215620L1 | Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 4, Myc-DDK-tagged |
USD 768.00 |
|
RC215620L2 | Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 4, mGFP tagged |
USD 620.00 |
|
RC215620L3 | Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 4, Myc-DDK-tagged |
USD 620.00 |
|
RC215620L4 | Lenti ORF clone of Human activating transcription factor 3 (ATF3), transcript variant 4, mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review