Dystrobrevin alpha (DTNA) (NM_032981) Human Tagged ORF Clone

CAT#: RC220954

DTNA (Myc-DDK-tagged)-Human dystrobrevin, alpha (DTNA), transcript variant 8


  "NM_032981" in other vectors (4)

Reconstitution Protocol

USD 420.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "DTNA"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DTNA
Synonyms D18S892E; DRP3; DTN; DTN-A; LVNC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220954 representing NM_032981
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCCAGATCAGCCTGAGAAGCCACTCAACTTGGCTCACATCGTGCTTCCCAGACCTGTAACCAGCA
TGAACGACACCCTGTTCTCCCACTCTGTTCCCTCCTCAGGAAGTCCTTTTATTACCAGGAGCATGCTTGA
GAGTTCAAACCGGCTTGATGAAGAACACAGGCTAATTGCCAGGTATGCGGCAAGGCTGGCAGCAGAGTCC
TCTTCGTCTCAGCCACCTCAGCAGAGAAGTGCTCCTGACATCTCTTTCACCATCGATGCGAATAAGCAGC
AAAGGCAGCTGATTGCTGAGCTAGAAAACAAGAACAGAGAAATCTTACAGGAGATCCAGAGACTTCGGCT
AGAGCATGAACAAGCTTCTCAGCCCACGCCAGAGAAGGCACAGCAAAACCCCACCCTGCTGGCAGAACTC
CGGCTCCTCAGACAGCGCAAAGATGAGCTGGAACAGAGAATGTCTGCTCTCCAGGAGAGCCGGAGAGAGC
TAATGGTCCAGTTGGAGGGTCTCATGAAGCTACTAAAGGAAGAAGAACTGAAGCAGGGAGTAAGTTATGT
CCCCTACTGCAGGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220954 representing NM_032981
Red=Cloning site Green=Tags(s)

MFPDQPEKPLNLAHIVLPRPVTSMNDTLFSHSVPSSGSPFITRSMLESSNRLDEEHRLIARYAARLAAES
SSSQPPQQRSAPDISFTIDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAEL
RLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEELKQGVSYVPYCRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032981
ORF Size 576 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032981.1, NM_032981.2, NM_032981.3, NM_032981.4, NP_116763.1
RefSeq Size 2181 bp
RefSeq ORF 579 bp
Locus ID 1837
Cytogenetics 18q12.1
Protein Families Druggable Genome
MW 21.9 kDa
Gene Summary 'The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.