CTIP1 (BCL11A) (NM_138559) Human Tagged ORF Clone

CAT#: RC223575

BCL11A (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3

Product Images

Western blot validation of overexpression lysate (Cat# LY408578) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC223575 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified BCL11A protein (Cat# TP323575). The protein was produced from HEK293T cells transfected with BCL11A cDNA clone (Cat# RC223575) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BCL11A
• Synonyms: BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; CTIP1; DILOS; EVI9; HBFQTL5; ZNF856
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC223575 representing NM_138559
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCTCGCCGCAAGCAAGGCAAACCCCAGCACTTAAGCAAACGGGAATTCTCGCCCGAGCCTCTTGAAG
  CCATTCTTACAGATGATGAACCAGACCACGGCCCGTTGGGAGCTCCAGAAGGGGATCATGACCTCCTCAC
  CTGTGGGCAGTGCCAGATGAACTTCCCATTGGGGGACATTCTTATTTTTATCGAGCACAAACGGAAACAA
  TGCAATGGCAGCCTCTGCTTAGAAAAAGCTGTGGATAAGCCACCTTCCCCTTCACCAATCGAGATGAAAA
  AAGCATCCAATCCCGTGGAGGTTGGCATCCAGGTCACGCCAGAGGATGACGATTGTTTATCAACGTCATC
  TAGAGGAATTTGCCCCAAACAGGAACACATAGCAGATAAACTTCTGCACTGGAGGGGCCTCTCCTCCCCT
  CGTTCTGCACATGGAGCTCTAATCCCCACGCCTGGGATGAGTGCAGAATATGCCCCGCAGGGTATTTGTA
  AAGATGAGCCCAGCAGCTACACATGTACAACTTGCAAACAGCCATTCACCAGTGCATGGTTTCTCTTGCA
  ACACGCACAGAACACTCATGGATTAAGAATCTACTTAGAAAGCGAACACGGAAGTCCCCTGACCCCGCGG
  GTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAG
  CTCGAGAGCCCTTAAGTTCTGAGAAAATT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC223575 representing NM_138559
  Red=Cloning site Green=Tags(s)
  
  MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ
  CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP
  RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR
  VLHTPPFGVVPRELKMCGSFRMEAREPLSSEKI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_138559
• ORF Size: 729 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_138559.1, NP_612569.1
• RefSeq Size: 2358
• RefSeq ORF: 732
• Locus ID: 53335
• Protein Families: Transcription Factors
• MW: 26.7 kDa
• Gene Summary: This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]