Rabbit Polyclonal Anti-BCL11A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the N terminal of human BCL11A. Synthetic peptide located within the following region: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ |
Rabbit Polyclonal Anti-BCL11A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the C terminal of human BCL11A. Synthetic peptide located within the following region: YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR |
Rabbit anti-BCL11A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BCL11A |
Rabbit Polyclonal Anti-Bcl11a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the N-terminal region of Rat Bcl11a. Synthetic peptide located within the following region: KREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIF |
Rabbit Polyclonal Ctip1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CTIP1 (BCL11A) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 806~835 amino acids from the C-terminal region of human BCL11A |
Rabbit Polyclonal anti-Bcl11a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl11a. Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL |
Mouse monoclonal Anti-BCL11A Clone BCL11A/123
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
