CGGBP1 (NM_001008390) Human Tagged ORF Clone
CAT#: RC223883
CGGBP1 (Myc-DDK-tagged)-Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1
"NM_001008390" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CGGBP1 |
Synonyms | CGGBP; p20-CGGBP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223883 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGCGATTTGTAGTAACAGCACCACCTGCTCGAAACCGTTCTAAGACTGCTTTGTATGTGACTCCCC TGGATCGAGTCACTGAGTTTGGAGGTGAGCTGCATGAAGATGGAGGAAAACTCTTCTGCACTTCTTGCAA TGTGGTTCTGAATCATGTTCGCAAGTCTGCCATTAGTGACCACCTCAAGTCAAAGACTCATACCAAGAGG AAGGCAGAATTTGAAGAGCAGAATGTGAGAAAGAAGCAGAGGCCCCTAACTGCATCTCTTCAGTGCAACA GTACTGCGCAAACAGAGAAAGTCAGTGTTATCCAGGACTTTGTGAAAATGTGCCTGGAAGCCAACATCCC ACTTGAGAAGGCTGATCACCCAGCAGTCCGTGCTTTCCTATCTCGCCATGTGAAGAATGGAGGCTCCATA CCTAAGTCAGACCAGCTACGGAGGGCATATCTTCCTGATGGATATGAGAATGAGAATCAACTCCTCAACT CACAAGATTGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223883 protein sequence
Red=Cloning site Green=Tags(s) MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKR KAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSI PKSDQLRRAYLPDGYENENQLLNSQDC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001008390 |
ORF Size | 501 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001008390.1, NP_001008391.1 |
RefSeq Size | 4608 bp |
RefSeq ORF | 504 bp |
Locus ID | 8545 |
Cytogenetics | 3p11.1 |
MW | 18.8 kDa |
Gene Summary | This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC301283 | CGGBP1 (untagged)-Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1 |
USD 420.00 |
|
RG223883 | CGGBP1 (GFP-tagged) - Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1 |
USD 460.00 |
|
RC223883L1 | Lenti ORF clone of Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, Myc-DDK-tagged |
USD 768.00 |
|
RC223883L2 | Lenti ORF clone of Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, mGFP tagged |
USD 620.00 |
|
RC223883L3 | Lenti ORF clone of Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, Myc-DDK-tagged |
USD 620.00 |
|
RC223883L4 | Lenti ORF clone of Human CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 1, mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review