Bcl2 Binding component 3 (BBC3) (NM_001127242) Human Tagged ORF Clone

CAT#: RC225019

  • TrueORF®

BBC3 (Myc-DDK-tagged)-Human BCL2 binding component 3 (BBC3), transcript variant 3


  "NM_001127242" in other vectors (4)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "BBC3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BBC3
Synonyms JFY-1; JFY1; PUMA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC225019 representing NM_001127242
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAATTTGGCATGGGGTCTGCCCAGGCATGTCCATGCCAGGTGCCCAGGGCTGCTTCCACGACGTGGG
TCCCCTGCCAGATTTGTGAGACAAGAGGAGCAGCAGCGGCACCGCCCCTCACCCTGGAGGGTCCTGTACA
ATCTCATCATGGGACTCCTGCCCTTACCCAGGGGCCACAGAGCCCCCGAGATGGAGCCCAATTAGGTGCC
TGCACCCGCCCGGTGGACGTCAGGGACTCGGGGGGCAGGCCCCTCCCACCTCCTGACACCCTGGCCAGCG
CGGGGGACTTTCTCTGCACCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC225019 representing NM_001127242
Red=Cloning site Green=Tags(s)

MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGA
CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001127242
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001127242.1, NM_001127242.2, NP_001120714.1
RefSeq Size 1359
RefSeq ORF 306
Locus ID 27113
Protein Families Druggable Genome
Protein Pathways Huntington's disease, p53 signaling pathway
MW 10.3 kDa
Gene Summary This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.