CBX1 (NM_001127228) Human Tagged ORF Clone

CAT#: RC225198

CBX1 (Myc-DDK-tagged)-Human chromobox homolog 1 (CBX1), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY426727) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC225198 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CBX1 protein (Cat# TP325198). The protein was produced from HEK293T cells transfected with CBX1 cDNA clone (Cat# RC225198) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CBX1
• Synonyms: CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC225198 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGAAAAAACAAAACAAGAAGAAAGTGGAGGAGGTGCTAGAAGAGGAGGAAGAGGAATATGTGGTGG
  AAAAAGTTCTCGACCGTCGAGTGGTAAAGGGCAAAGTGGAGTACCTCCTAAAGTGGAAGGGATTCTCAGA
  TGAGGACAACACATGGGAGCCAGAAGAGAACCTGGATTGCCCCGACCTCATTGCTGAGTTTCTGCAGTCA
  CAGAAAACAGCACATGAGACAGATAAATCAGAGGGAGGCAAGCGCAAAGCTGATTCTGATTCTGAAGATA
  AGGGAGAGGAGAGCAAACCAAAGAAGAAGAAAGAAGAGTCAGAAAAGCCACGAGGCTTTGCTCGAGGTTT
  GGAGCCGGAGCGGATTATTGGAGCTACAGACTCCAGTGGAGAGCTCATGTTCCTGATGAAATGGAAAAAC
  TCTGATGAGGCTGACCTGGTCCCTGCCAAGGAAGCCAATGTCAAGTGCCCACAGGTTGTCATATCCTTCT
  ATGAGGAAAGGCTGACGTGGCATTCCTACCCCTCGGAGGATGATGACAAAAAAGATGACAAGAAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC225198 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS
  QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN
  SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001127228
• ORF Size: 555 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001127228.1, NP_001120700.1
• RefSeq Size: 2253 bp
• RefSeq ORF: 558 bp
• Locus ID: 10951
• MW: 21.4 kDa
• Gene Summary: This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]