APBB2 (NM_001166051) Human Tagged ORF Clone

CAT#: RC228759

APBB2 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor protein-binding, family B, member 2 (APBB2), transcript variant 4

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: APBB2
• Synonyms: FE65L; FE65L1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC228759 representing NM_001166051
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGAACGGAAGAATGCCAAAGCGCTGGCCTGCAGCTCCTTACAGGAAAGGGCCAATGTGAACCTCG
  ATGTCCCTTTGCAAGTAGATTTTCCAACACCAAAGACTGAGCTGGTCCAGAAGTTCCACGTGCAGTACTT
  GGGCATGTTACCTGTAGACAAACCAGTCGGAATGGATATTTTGAACAGTGCCATAGAAAATCTTATGACC
  TCATCCAACAAGGAGGACTGGCTGTCAGTGAACATGAACGTGGCTGATGCCACTGTGACTGTCATCAGTG
  AAAAGAATGAAGAGGAAGTCTTAGTGGAATGTCGTGTGCGATTCCTGTCCTTCATGGGTGTTGGGAAGGA
  CGTCCACACATTTGCCTTCATCATGGACACGGGGAACCAGCGCTTTGAGTGCCACGTTTTCTGGTGCGAG
  CCTAATGCTGGTAACGTGTCTGAGGCGGTGCAGGCCGCCTGCATGTTACGATATCAGAAGTGCTTGGTAG
  CCAGGCCGCCTTCTCAGAAAGTTCGACCACCTCCACCGCCAGCAGATTCAGTAACCAGAAGAGTCACAAC
  CAATGTAAAACGAGGGGTCTTATCCCTCATTGACACTTTGAAACAGAAACGCCCTGTCACCGAAATGCCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC228759 representing NM_001166051
  Red=Cloning site Green=Tags(s)
  
  MAERKNAKALACSSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMT
  SSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCE
  PNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001166051
• ORF Size: 630 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001166051.1, NP_001159523.1
• RefSeq Size: 7022 bp
• RefSeq ORF: 633 bp
• Locus ID: 323
• Cytogenetics: 4p14-p13
• Protein Families: Transcription Factors
• MW: 23.5 kDa
• Gene Summary: 'The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. Polymorphisms in this gene have been associated with Alzheimer's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]'